PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000381514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 415aa    MW: 47069.3 Da    PI: 6.8953
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000381514genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.99e-41161281128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    +ppGfrFhPt+eel+++yLkkk+++++++l  vi+evd++k+ePw                s++dkky+tg+r+nrat++g+Wkatg+dk ++s +
  MDP0000381514  16 VPPGFRFHPTEEELLQYYLKKKASNQRIDL-XVIREVDLNKLEPWGYT-------------SHKDKKYPTGTRTNRATAAGFWKATGRDKVICS-N 96 
                    69****************************.99************985.............6899***************************99.8 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +g++ktLvfykgrap+g+k+dW+mheyrl
  MDP0000381514  97 CRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 128
                    889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-4910171IPR003441NAC domain
PROSITE profilePS5100543.47116171IPR003441NAC domain
PfamPF023652.1E-2417128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MAPENMSISV NGQSQVPPGF RFHPTEEELL QYYLKKKASN QRIDLXVIRE VDLNKLEPWG  60
YTSHKDKKYP TGTRTNRATA AGFWKATGRD KVICSNCRRI GMRKTLVFYK GRAPHGQKSD  120
WIMHEYRLDD NNTSNYSISN VSHFEYPTIV PTVVGDAAQE EGWVVCRIFK KKNLHRSLSS  180
PILSPTTSIT SETKSGQSLF DSCPXGALEQ IIQYMGRACK EEENEAYISN NSTRFNLQPI  240
NTGISNTINH IGFHERFLKL PTLDSPNSTS SQDCYQPNIH EEMMVTEVNN NQMSPFTDHH  300
QNMDYHAHHM DSGLTNWATF DRLVASQLNG QTEXSRQLAC FITDPXNTIS YDNDDHDHEL  360
QLRSTLRGSL SSPNKSYQAT HDYNNSAIDL WNFDRQSSSL SSSDKLCHVS NGPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-411617315170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9199630.0KJ919963.1 Eriobotrya japonica NAC2 transcription factor (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366608.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-111NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0H3VAS80.0A0A0H3VAS8_9R
STRINGVIT_15s0048g02660.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.12e-96NAC family protein